The domain within your query sequence starts at position 25 and ends at position 170; the E-value for the UPF0020 domain shown below is 3.8e-8.
LLEQYPTRPHIAACMLYTIHNTYDDIENKAVADLGCGCGVLSIGAAMLGAGLCVGFDIDE DALEIFNKNVEEFELTNVDMIQCDVYSLSNRMSKLFDTVIMNPPFGTKNNKGTDMAFLKT ALGMARTAVYSLHKSSTREHIQKKAA
UPF0020 |
![]() |
---|
PFAM accession number: | PF01170 |
---|---|
Interpro abstract (IPR000241): | This domain is probably a methylase. It is associated with the THUMP domain that also occurs with RNA modification domains [ (PUBMED:11295541) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0020