The domain within your query sequence starts at position 44 and ends at position 164; the E-value for the UPF0066 domain shown below is 1.2e-46.

IGTPRQPSICSHSRACLKIRKNIFNNPEHSLMGLEEFSHVWILFVFHKNGHLNYKAKVQP
PRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAVYLSGVDMIDGTPVLDIKPYIADY
D

UPF0066

UPF0066
PFAM accession number:PF01980
Interpro abstract (IPR023370): YaeB (also known as TsaA or TrmO) is a RNA methyltransferase responsible for N6-methylation of N6-threonylcarbamoyladenosine in tRNAs. It has a unique single-sheeted beta-barrel structure and represent a new category of AdoMet-dependent methyltransferases [(PUBMED:25063302)].

The following uncharacterised proteins have been shown to be evolutionary related and to contain a YaeB-like beta barrel structural domain domain:

  • Agrobacterium tumefaciens Ti plasmid protein virR.
  • Pseudomonas aeruginosa protein rcsF.
  • Archaeoglobus fulgidus hypothetical protein AF0241.
  • Archaeoglobus fulgidus hypothetical protein AF0433.
  • Methanococcus jannaschii hypothetical protein MJ1583.
  • Methanobacterium thermoautotrophicum hypothetical protein MTH1797.
  • Mammalian Nef-associated protein 1 (NAP1).

The crystal structure of Haemophilus influenzae YaeB has been solved. In addition to the N-terminal beta-barrel methyltransferase domain it has a C-terminal domain containing the conserved sequence motif DPRxxY [(PUBMED:25063302)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0066