The domain within your query sequence starts at position 7 and ends at position 61; the E-value for the UPF0121 domain shown below is 5.9e-7.

NGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGEYFSSLVIFFAPCC

UPF0121

UPF0121
PFAM accession number:PF03661
Interpro abstract (IPR005344):

This entry represents the TMEM33/Pom33 family. Budding yeast Pom33 is a transmembrane nucleoporin that contributes to proper distribution and/or efficient assembly of nuclear pores [(PUBMED:20498018)]. Proteins in this entry also include Tts1 from fission yeasts [(PUBMED:20434336)], Kr-h2 (krueppel homologue 2) from flies [(PUBMED:10816971)] and TMEM33 from vertebrates [(PUBMED:25612671)].

Tts1 is required for the correct positioning of the cellular division plane by delimiting the actomyosin ring assembly at the cell equator [(PUBMED:20434336)].

Kr-h2 is a member of the dosage-dependent hierarchy effective upon white gene expression [(PUBMED:10816971)].

TMEM33 regulates the tubular structure of endoplasmic reticulum by suppressing the membrane-shaping activity of reticulons [(PUBMED:25612671)].

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0121