The domain within your query sequence starts at position 5 and ends at position 88; the E-value for the UPF0139 domain shown below is 1.4e-37.
NMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCS FISFANSRSSEDTKQMMSSFIILS
UPF0139 |
---|
PFAM accession number: | PF03669 |
---|---|
Interpro abstract (IPR005351): | This is a small family of proteins of unknown function which appear to be related to the hypothetical protein CG10674 from Drosophila melanogaster (Fruit fly)( Q9VRJ8 ). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0139