The domain within your query sequence starts at position 204 and ends at position 306; the E-value for the UPF0160 domain shown below is 3.3e-43.
PNQDTEVDSSGEIVELAKGGCPWKEHLYHLESELSPKVAITFVIYTDQAGQWRVQCVPKE PHSFQSRLPLPEPWRGLRDKALDQVSGIPGCIFVHASGFIGGH
UPF0160 |
 |
|---|
| PFAM accession number: | PF03690 |
|---|---|
| Interpro abstract (IPR003226): | The function of this domain is not known, but it is found in several uncharacterised proteins and a probable metal dependent protein hydrolase. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0160