The domain within your query sequence starts at position 1 and ends at position 101; the E-value for the UPF0172 domain shown below is 6.8e-43.

MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHPPGAGSHTLFVDCIPLFHG
TLALTPMLEVALTLIDSWCKDNSYVIAGYYQANERVKDARG

UPF0172

UPF0172
PFAM accession number:PF03665
Interpro abstract (IPR005366):

Saccharomyces cerevisiae ER membrane protein complex (EMC) comprises six subunits [(PUBMED:19325107)]. Four and three additional subunits have been identified in mammals and Drosophila, respectively [(PUBMED:22119785)]. EMC is required for protein folding in the endoplasmic reticulum (ER). It also facilitates lipid transfer from ER to mitochondria [(PUBMED:25313861)].

This family includes mammalian subunits EMC8 and EMC9, and Drosophila EMC8/9 homologue [(PUBMED:25715730)]. EMC8 is also known as neighbour of COX4 (NOC4) [(PUBMED:10337626)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0172