The domain within your query sequence starts at position 1 and ends at position 101; the E-value for the UPF0172 domain shown below is 6.8e-43.
MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHPPGAGSHTLFVDCIPLFHG TLALTPMLEVALTLIDSWCKDNSYVIAGYYQANERVKDARG
UPF0172 |
---|
PFAM accession number: | PF03665 |
---|---|
Interpro abstract (IPR005366): | Saccharomyces cerevisiae ER membrane protein complex (EMC) comprises six subunits [ (PUBMED:19325107) ]. Four and three additional subunits have been identified in mammals and Drosophila, respectively [ (PUBMED:22119785) ]. EMC is required for protein folding in the endoplasmic reticulum (ER). It also facilitates lipid transfer from ER to mitochondria [ (PUBMED:25313861) ]. This family includes mammalian subunits EMC8 and EMC9, and Drosophila EMC8/9 homologue [ (PUBMED:25715730) ]. EMC8 is also known as neighbour of COX4 (NOC4) [ (PUBMED:10337626) ]. |
GO component: | ER membrane protein complex (GO:0072546) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0172