The domain within your query sequence starts at position 1 and ends at position 83; the E-value for the UPF0184 domain shown below is 5.5e-46.

MSGPNGDLGMPVDAGTEGENDSFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELL
ESNRQTRLEFQQQLGEAPGDASP

UPF0184

UPF0184
PFAM accession number:PF03670
Interpro abstract (IPR022788):

This family of proteins has no known function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0184