The domain within your query sequence starts at position 1 and ends at position 54; the E-value for the UPF0193 domain shown below is 5e-7.
MASQERVDSVTKGTGFRRCRKQAGYTPGTCELLRVFGLHVCLQARRGHQIPLQM
UPF0193 |
![]() |
---|
PFAM accession number: | PF05250 |
---|---|
Interpro abstract (IPR007914): | This family of proteins is functionally uncharacterised. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0193