The domain within your query sequence starts at position 4 and ends at position 213; the E-value for the UPF0193 domain shown below is 3.2e-92.

QERVDSVTKGTGFRRCRKQAGYTPGTCELLRVMMKESKLTNFQQRHIMDTMKRGAPLPLQ
CNPTSSLRGSPSKKAASAIYLPPILATHSHLRPASLCQANGAYSREQFKPQATRDLEKEK
RRLQNIFATGKDKEERKKVPHVRQEDPAPELDRFDELVKEIQDRKEFLAAMEALGQGRQY
RSIILAEISQKLREMEDIDRRRSKELRKAL

UPF0193

UPF0193
PFAM accession number:PF05250
Interpro abstract (IPR007914):

This family of proteins is functionally uncharacterised.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0193