The domain within your query sequence starts at position 1 and ends at position 70; the E-value for the UPF0203 domain shown below is 1.1e-30.
MNSVGEACTDMKREYDQCFNRWFAEKFLKGDGSGDPCTDLFKRYQQCVQKAIKEKEIPIE GLEFMGHGKE
UPF0203 |
---|
PFAM accession number: | PF05254 |
---|---|
Interpro abstract (IPR007918): | This is a family of small highly conserved proteins. In Saccharomyces cerevisiae (Baker's yeast) the gene YKL053C-A (MDM35) O60200 is one of the genes essential for maintenance of normal mitochondrial distribution and morphology (MDM) [ (PUBMED:11907266) ]; wherease in Homo sapiens (Human), p53CSV, O43715 is a direct transcriptional target for p53 and appears to be a cell-survival mediator in response to genotoxic stress including low-levels of DNA damage. It is suggested that p53CSV modulates the apoptotic pathway through interaction with HSP70 and Apaf-1 thereby inhibiting activation of procaspase-3 and procaspase-9 [ (PUBMED:15735003) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0203