The domain within your query sequence starts at position 1 and ends at position 85; the E-value for the UPF0239 domain shown below is 3.3e-45.
MASDLGFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEQAEPRSA EGPKKPKVAIASTNKRPKKETKKKR
UPF0239 |
---|
PFAM accession number: | PF06783 |
---|---|
Interpro abstract (IPR009621): | This is a group of transmembrane proteins of unknown function. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0239