The domain within your query sequence starts at position 1 and ends at position 169; the E-value for the UPF0240 domain shown below is 6.4e-67.
MGARVTRALRNFNVEKRAEREISKRKPSMAPKHPSTRDLLQEHRSQYPEIEEVVSKKDNK LLSLLRDVYVDSKDPVPALPVKVEPRQEPKEFRLPIGNHFDKNITDIPKGKITVVEALTL LNNHKLSPETWTAEKIAQEYYLELKDVNSLLKYFVTFEVKILPPEDRKA
UPF0240 |
---|
PFAM accession number: | PF06784 |
---|---|
Interpro abstract (IPR009622): | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 (NDUFAF4, also known as HRPAP20) is involved in the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I) [ (PUBMED:14871833) ]. It may be involved in cell proliferation and survival of hormone-dependent tumor cells [ (PUBMED:17001319) ]. |
GO process: | mitochondrial respiratory chain complex I assembly (GO:0032981) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0240