The domain within your query sequence starts at position 24 and ends at position 114; the E-value for the UPF0444 domain shown below is 1.7e-48.
KDHPQQQPGMLSRVTGGIFSVTKGAVGATIGGVAWIGGKSLEVTKTAVTTVPSMGIGLVK GGVSAVAGGVTAVGSAVVNKVPLSGKKKDKS
UPF0444 |
---|
PFAM accession number: | PF15475 |
---|---|
Interpro abstract (IPR028153): | Proteins in this family are multi-pass membrane proteins from eukaryotes. Proteins in this family are typically between 94 and 119 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0444