The domain within your query sequence starts at position 6 and ends at position 103; the E-value for the UPF0449 domain shown below is 7.5e-40.
KKRVVLPTRPAPPTVEQILEDVRGAPAQDPVFTALAPEDPPDPSPRAEDSEIQQEQIYQQ SRAYVAMNERLRQAGEALRQKFDGLRQAGQRLEQDISQ
UPF0449 |
![]() |
---|
PFAM accession number: | PF15136 |
---|---|
Interpro abstract (IPR028227): | This family of proteins is found in eukaryotes and it is functionally uncharacterised. Proteins in this family have a conserved LPTRP sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0449