The domain within your query sequence starts at position 10 and ends at position 365; the E-value for the UPF0492 domain shown below is 6.4e-170.

CGNFAVLVDLHVLPQGSNRDSSWFSEQKKEEVCLLLKETIDSRVKEYVGIYKQRKPSSAE
FTRSSPLSLKGYGFQITAYFLKRGIHLHCIQNSQNTELRVFPERFVVCVSQLAFGHDIWA
NQNEKSTKKALHGVSDYFPECAESSPSPGTKLKRNALKEIVRRTKSKGTDVSKPQPSGDL
VGRSSDSVITVVPWRRDASAILLSESVGQAQDDIRAAKSHQELPVQKLENVSQTQPGDTR
SQQQLHPGEWLKTGLLSRSPAYNYESASPGPKQSLRAAKTQQKHRNCGSVEDCDHRRRVS
LGNEGLVPEDADRERSTAVRVLPALELSDPGLLLKQDLAKAKAKEELHALENLSSR

UPF0492

UPF0492
PFAM accession number:PF15744
Interpro abstract (IPR031479): SLX4IP (SLX4-interacting protein) encodes an uncharacterised DNA repair-related protein [(PUBMED:19596235)]. Deletions of SLX4IP have been associated with childhood lymphoblastic leukemia [(PUBMED:24045615)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0492