The domain within your query sequence starts at position 16 and ends at position 272; the E-value for the UPF0515 domain shown below is 1.3e-127.

REKFHGKVSPKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDQ
DIQAVATSLLPLTQANLRMFQRAQDDLIPAVDRQFACSSCDHVWWRRVPQRKEVSRCRKC
RKRYEPVPLDKMWGLAEFHCPKCRHNFRGWAQMGSPSPCYGCGFPVYPTRILPPRWDRDL
DRRSTHTHSCSAADCYNRREPHVPGTSCAHPKSRKQNHLPKVLHPSNPHISSGSTVATCL
SQGGLVDDLDHLILEDL

UPF0515

UPF0515
PFAM accession number:PF15135
Interpro abstract (IPR026795): Repressor of yield of DENV (RyDEN) has been identified as a interferon-stimulated cellular inhibitor against Dengue Virus (DENV) and other viruses replication [(PUBMED:26735137)]. It is likely to interfere with the translation of DENV via interaction with viral RNA and cellular mRNA-binding proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0515