The domain within your query sequence starts at position 4 and ends at position 71; the E-value for the UPF0542 domain shown below is 3.9e-36.

IKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQE
NIAKAKRL

UPF0542

UPF0542
PFAM accession number:PF15086
Interpro abstract (IPR027877):

This family of eukaryotic proteins is functionally uncharacterised. There is a conserved LSWKL sequence motif. This family includes human protein C5orf43. Family members are annotated as small integral membrane protein 15.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0542