The domain within your query sequence starts at position 4 and ends at position 71; the E-value for the UPF0542 domain shown below is 3.9e-36.
IKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQKRQE NIAKAKRL
UPF0542 |
---|
PFAM accession number: | PF15086 |
---|---|
Interpro abstract (IPR027877): | This family of eukaryotic proteins is functionally uncharacterised. There is a conserved LSWKL sequence motif. This family includes human protein C5orf43. Family members are annotated as small integral membrane protein 15. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0542