The domain within your query sequence starts at position 1 and ends at position 224; the E-value for the UPF0552 domain shown below is 4e-110.
MSRIYQDSALRNKAVQSARLPGTWDPATHQGGNGILLEGELVDVSRHSILDAHGRKERYY VLYIQPSCIHRRKFDPKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTLEALKSLV NKPQLLELTESLTPDQAVAFWMPESEMEVMELELGTGVRLKTRGDGPFIDSLAKLELGTV TKCNFAGDGKTGASWTDNIMAQKSSERNTAEIREQGDGAEDEEW
UPF0552 |
---|
PFAM accession number: | PF10574 |
---|---|
Interpro abstract (IPR018889): | Arpin regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex [ (PUBMED:24132237) ]. It induces cell turning by pausing cell migration [ (PUBMED:26235381) ]. |
GO process: | negative regulation of actin nucleation (GO:0051126) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0552