The domain within your query sequence starts at position 11 and ends at position 166; the E-value for the UPF0556 domain shown below is 4.8e-82.
AVVLAAAALKLAAAVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQW QMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLK SEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
UPF0556 |
---|
PFAM accession number: | PF10572 |
---|---|
Interpro abstract (IPR018887): | The function of myeloid-derived growth factor is to protect and repair the heart after myocardial infarction [ (PUBMED:25581518) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0556