The domain within your query sequence starts at position 11 and ends at position 166; the E-value for the UPF0556 domain shown below is 4.8e-82.

AVVLAAAALKLAAAVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQW
QMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLK
SEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL

UPF0556

UPF0556
PFAM accession number:PF10572
Interpro abstract (IPR018887): The function of myeloid-derived growth factor is to protect and repair the heart after myocardial infarction [(PUBMED:25581518)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0556