The domain within your query sequence starts at position 1 and ends at position 69; the E-value for the UPF0640 domain shown below is 4.6e-39.

MFSRAQVRRALQRVPGKQRFGIYRFLPFFFVLGGAMEWIMIKVRVGQETFYDVYRRKASE
RQYQRRLED

UPF0640

UPF0640
PFAM accession number:PF15114
Interpro abstract (IPR028183):

Proteins in this family are uncharacterised single-pass membrane proteins found in eukaryotes. Proteins in this family include small integral membrane protein 4 (Smim4). There are two conserved sequence motifs: PGK and YRFLP.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0640