The domain within your query sequence starts at position 2 and ends at position 68; the E-value for the UPF0640 domain shown below is 9.1e-28.
FSRAQVRRALQRVPGKQRFGIYRFLPFFFVLGGAMEWIMIKVRVGQETFCFLPEMFKMKT TKHLSLD
UPF0640 |
---|
PFAM accession number: | PF15114 |
---|---|
Interpro abstract (IPR028183): | Proteins in this family are uncharacterised single-pass membrane proteins found in eukaryotes. Proteins in this family include small integral membrane protein 4 (Smim4). There are two conserved sequence motifs: PGK and YRFLP. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF0640