The domain within your query sequence starts at position 116 and ends at position 267; the E-value for the UPF1_Zn_bind domain shown below is 4.1e-78.
HACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHLVRAKCKEVTLHKDGPLGETV LECYNCGCRNVFLLGFIPAKADSVVVLLCRQPCASQSSLKDINWDSSQWQPLIQDRCFLS WLVKIPSEQEQLRARQITAQQINKLEELWKEN
UPF1_Zn_bind |
---|
PFAM accession number: | PF09416 |
---|---|
Interpro abstract (IPR018999): | UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) [ (PUBMED:16931876) ]. |
GO process: | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (GO:0000184) |
GO component: | cytoplasm (GO:0005737) |
GO function: | helicase activity (GO:0004386), zinc ion binding (GO:0008270), ATP binding (GO:0005524), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UPF1_Zn_bind