The domain within your query sequence starts at position 916 and ends at position 1127; the E-value for the USP7_C2 domain shown below is 4.9e-63.

KLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGDK
ASGRLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAH
FHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINED
EYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAP

USP7_C2

USP7_C2
PFAM accession number:PF14533
Interpro abstract (IPR029346):

This domain is found in the C-terminal of the ubiquitin carboxyl-terminal hydrolases (USPs). Its function is not clear [(PUBMED:14506283)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry USP7_C2