The domain within your query sequence starts at position 661 and ends at position 906; the E-value for the USP7_ICP0_bdg domain shown below is 7.1e-79.

IRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKF
DKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCDRAGFIQDTSLILYEEVK
PNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFC
DKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEG
TLRDLL

USP7_ICP0_bdg

USP7_ICP0_bdg
PFAM accession number:PF12436
Interpro abstract (IPR024729):

This domain is found in proteins of the peptidase C19 family, which contains ubiquitinyl hydrolases like ubiquitin carboxyl-terminal hydrolase 7 (USP7) [(PUBMED:14506283)]. This domain is one of two C-terminal domains on the much longer ubiquitin-specific proteases. It is found to interact with the herpesvirus 1 trans-acting transcriptional protein ICP0/VMW110.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry USP7_ICP0_bdg