The domain within your query sequence starts at position 343 and ends at position 490; the E-value for the UTP15_C domain shown below is 3.5e-50.

NYLKQRDDIMVSRPAKKHLEGYDKDLKSFRVSQALDRVLEPKCVIRTPEVTVSIIKELTR
RGVLANALAGRDEKEVTRVLNFLIRNLSQPRFAPVLINAAEIIIDIYLPVIGQSSVVDKK
FIVLQELVEKEIDYQRELLETLGMMDML

UTP15_C

UTP15_C
PFAM accession number:PF09384
Interpro abstract (IPR018983):

This entry represents the C-terminal domain of the U3 small nucleolar RNA-associated protein 15 (UTP15). This protein is involved in nucleolar processing of pre-18S ribosomal RNA, and is required for optimal pre-ribosomal RNA transcription by RNA polymerase I together with a subset of U3 proteins required for transcription (t-UTPs). UTP15 is a component of the ribosomal small subunit (SSU) processome, which is a large ribonucleoprotein (RNP) required for processing of precursors to the small subunit RNA, the 18S, of the ribosome [(PUBMED:15590835), (PUBMED:15489292)]. This domain is found C-terminal to the WD40 repeat (IPR001680). UTP15 associates with U3 snoRNA, which is ubiquitous in eukaryotes and is required for nucleolar processing of pre-18S ribosomal RNA [(PUBMED:12068309)].

GO process:rRNA processing (GO:0006364)
GO component:nucleolus (GO:0005730)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UTP15_C