The domain within your query sequence starts at position 288 and ends at position 763; the E-value for the UTP25 domain shown below is 6.1e-200.

TPLQKELFLIMNSYRDLFYPERTALKNGEEVRHVYCLHAINHVLKANAQVLANNSRRRSQ
KLGVGEDDDFRDQGLTRPKVLIVVPFREAALRVVQLFISLLEGDSKKKIIVSNKKRFQGE
YGSDPEERPPNLKRPEDYEAVFVGNIDDHFRIGVAILQRSIRLYAPFYSSDILIASPLGL
RTIIGGEGEKKRDFDFLSSVELLIIDQADIYLMQNWEHVLHLMNHMNLLPLDSHGVDFSR
VRMWSLNNWSKYYRQTLLFGALQDAQINSVFNKHCINAQGQVAVRNVPMTGSISHVLVQL
PHVFQRMEAQDLSSVIDARFHFFINKILPQYRDAVMSHTLIYVPSYFDFVRLRNYFKKEE
LNFTHICEYTQKSGISRARHFFLQGEKQFLLLTERFHFYKRYTIKGIRNLIFYELPTYPH
FYSEVCNMLRATSRGEEATWTCTVLYSKYDAQRLAAVVGVERAAQMLQSPKNVHLF

UTP25

UTP25
PFAM accession number:PF06862
Interpro abstract (IPR010678):

This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [(PUBMED:12006978), (PUBMED:16322560)].

GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UTP25