The domain within your query sequence starts at position 1 and ends at position 78; the E-value for the UXS1_N domain shown below is 5.2e-42.
MVSKGLLRLVSSVNRRRMKLLLGIALFAYAASVWGNFVNMRSIQENGELKIESKIEEIVE PLREKIRDLEKSFTQKYP
UXS1_N |
---|
PFAM accession number: | PF11803 |
---|---|
Interpro abstract (IPR021761): | The N terminus of the UDP-glucuronate decarboxylases may be involved in localisation to the perinuclear Golgi membrane [ (PUBMED:11877387) (PUBMED:18485801) ]. |
GO function: | UDP-glucuronate decarboxylase activity (GO:0048040) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UXS1_N