The domain within your query sequence starts at position 59 and ends at position 326; the E-value for the Ubie_methyltran domain shown below is 1.4e-91.
VSEGEKGSKVYQVFENVAKKYDLMNDMMSLGIHRAWKDLLIRKMHPLPGTQLLDMAGGTG DIAFRFLSYVQAQHQRRQRRQLRTQQNLSWEEIAKKYQNEEDSLGGSLATVCDINREMLK VGKQKALDQGHTAGLAWVLGDAEELPFDDDSFDVYTIAFGIRNVTHIDQALQEAHRVLKP GGRFLCLEFGQVNDPLISRLYDLYSFQVIPVIGEVIAGDWKSYQYLVESIRKFPNQEDFK DMIEDAGFQRVTYENLTTGIVAIHSGFK
Ubie_methyltran |
---|
PFAM accession number: | PF01209 |
---|---|
Interpro abstract (IPR004033): | This entry represents a family of methyltransferases involved in the biosynthesis of menaquinone and ubiqinone. Some members such as the UbiE enzyme from E. coli [ (PUBMED:9045837) ] are believed to act in both pathways, while others may act in only the menaquinone pathway. These methyltransferases are members of the UbiE/CoQ family of methyltransferases which also contains ubiquinone methyltransferases and other methyltransferases. Members of this clade include a wide distribution of bacteria and eukaryotes, but no archaea. An outgroup for this clade is provided by the phosphatidylethanolamine methyltransferase ( EC 2.1.1.17 ) from Rhodobacter sphaeroides [ (PUBMED:8340421) ]. Note that a number of non-orthologous genes which are members of IPR005493 have been erroneously annotated as MenG methyltransferases. |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ubie_methyltran