The domain within your query sequence starts at position 2 and ends at position 77; the E-value for the Ubiq-Cytc-red_N domain shown below is 6.4e-30.

LSVAARSGPFAPVLSATSRGVAGALRPLLQGAVPAASEPPVLDVKRPFLCRESLSGQAAA
RPLVATVGLNVPASVR

Ubiq-Cytc-red_N

Ubiq-Cytc-red_N
PFAM accession number:PF09165
Interpro abstract (IPR015248):

The N-terminal domain of the ubiquinol-cytochrome c reductase iron-sulphur subunit adopts a structure consisting of many antiparallel beta sheets, with few alpha helices, in a non-globular arrangement. They are required for proper functioning of the respiratory chain [(PUBMED:12269811)].

GO process:oxidation-reduction process (GO:0055114)
GO function:ubiquinol-cytochrome-c reductase activity (GO:0008121)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ubiq-Cytc-red_N