SMART: Pfam domain Ubiq_cyt_C

The domain within your query sequence starts at position 63 and ends at position 203; the E-value for the Ubiq_cyt_C_chap domain shown below is 2.1e-45.

LRCQMPDTFNSWFLITLLHVWMCLVRMKQEGRTGKYMCRIIVHFMWEDVEQRGRVMGVNS
YILKKNMALMTNNFYAAILGYDEGILSDDHGLAAALWRTFFNQKCEDPRQLELLVEYVRK
QMQYLDSMNGEDLLLTGEVRW

Ubiq_cyt_C_chap

PFAM accession number:	PF03981
Interpro abstract (IPR021150):	Saccharomyces cerevisiae ubiquinol-cytochrome C chaperone is required for assembly of coenzyme QF-2-cytochrome C reductase. It appears to be found in a number of different organisms including Homo sapiens, Caenorhabditis elegans and Rhizobium meliloti. This entry also contains bacterial proteins belonging to the UPF0174 family.

PFAM accession number:

PF03981

Interpro abstract (IPR021150):

Saccharomyces cerevisiae ubiquinol-cytochrome C chaperone is required for assembly of coenzyme QF-2-cytochrome C reductase. It appears to be found in a number of different organisms including Homo sapiens, Caenorhabditis elegans and Rhizobium meliloti.

This entry also contains bacterial proteins belonging to the UPF0174 family.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ubiq_cyt_C_chap