The domain within your query sequence starts at position 139 and ends at position 226; the E-value for the Ubiquitin_3 domain shown below is 6.7e-34.

ELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKL
DNTIQDAGLYQGQVLVIEPQNEDGTWPR

Ubiquitin_3

Ubiquitin_3
PFAM accession number:PF14836
Interpro abstract (IPR028135):

This ubiquitin-like (UBL) domain is found in several ubiquitin carboxyl-terminal hydrolases, also known as ubiquitin specific proteases (USP) [(PUBMED:21848306)], and in gametogenetin-binding protein.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ubiquitin_3