The domain within your query sequence starts at position 462 and ends at position 1083; the E-value for the Ufd2P_core domain shown below is 1.3e-199.

LGAFFSFSVFAEDDAKVVEKYFSGPAITLENTRVVSQSLQHYLELGRQELFKILHSILLN
GETREAALSYMAALVNANMKKAQMQADDRLVSTDGFMLNLLWVLQQLSTKIKLETVDPTY
IFHPRCRITLPNDETRINATMEDVNERLTELYGDQPPFSEPKFPTECFFLTLHAHHLSIL
PSCRRYIRRLRAIRELNRTVEDLKNNESQWKDSPLATRHREMLKRCKTQLKKLVRCKACA
DAGLLDESFLRRCLNFYGLLIQLMLRILDPAYPDVTLPLNSEVPKVFAALPEFYVEDVAE
FLFFIVQYSPQVLYEPCTQDIVMFLVVMLCNQNYIRNPYLVAKLVEVMFMTNPSVQPRTQ
KFFEMIENHPLSTKLLVPSLMKFYTDVEHTGATSEFYDKFTIRYHISTIFKSLWQNIAHH
GTFMEEFNSGKQFVRYINMLINDTTFLLDESLESLKRIHEVQEEMKNKEQWDQLPRDQQQ
ARQSQLAQDERVSRSYLALATETVDMFHLLTKQVQKPFLRPELGPRLAAMLNFNLQQLCG
PKCRDLKVENPEKYGFEPKKLLDQLTDIYLQLDCARFAKAIADDQRSYSKELFEEVISKM
RKAGIKSTIAIEKFKLLAEKVE

Ufd2P_core

Ufd2P_core
PFAM accession number:PF10408
Interpro abstract (IPR019474):

This entry represents the most conserved part of the core region of ubiquitin conjugation factor E4 (or Ub elongating factor, or Ufd2P), running from helix alpha-11 to alpha-38. It consists of 31 helices of variable length connected by loops of variable size forming a compact unit; the helical packing pattern of the compact unit consists of five structural repeats that resemble tandem Armadillo (ARM) repeats. This domain is involved in ubiquitination as it binds Cdc48p and escorts ubiquitinated proteins from Cdc48p to the proteasome for degradation. The core is structurally similar to the nuclear transporter protein importin-alpha. The core is associated with the U-box at the C terminus, (IPR003613), which has ligase activity.

Ubiquitin conjugation factor E4 is involved in N-terminal ubiquitin fusion degradation proteolytic pathway (UFD pathway). E4 binds to the ubiquitin moieties of preformed conjugates and catalyses ubiquitin chain assembly in conjunction with E1, E2, and E3. E4 appears to influence the formation and topology of the multi-Ub chain as it enhances ubiquitination at 'Lys-48' but not at 'Lys-29' of the N-terminal Ub moiety.

GO process:ubiquitin-dependent protein catabolic process (GO:0006511), protein ubiquitination (GO:0016567)
GO component:ubiquitin ligase complex (GO:0000151)
GO function:ubiquitin-ubiquitin ligase activity (GO:0034450)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ufd2P_core