The domain within your query sequence starts at position 2 and ends at position 55; the E-value for the Ufm1 domain shown below is 5e-36.

SKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNGKE

Ufm1

Ufm1
PFAM accession number:PF03671
Interpro abstract (IPR005375):

This entry represents Ufm1 (ubiquitin-fold modifier), which is a ubiquitin-like protein with structural similarities to ubiquitin [ (PUBMED:10884686) (PUBMED:15071506) ]. Ufm1 is one of a number of ubiquitin-like modifiers that conjugate to target proteins in cells through Uba5 (E1) and Ufc1 (E2). The Ufm1-system is conserved in metazoa and plants, suggesting it has a potential role in multicellular organisms [ (PUBMED:16527251) ]. Human Ufm1 is synthesized as a precursor consisting of 85 amino-acid residues. Prior to activation by Uba5, the extra amino acids at the C-terminal region of Ufm1 are removed to expose Gly, which is necessary for conjugation to target molecule(s). C-terminal processing of Ufm1 requires two specific cysteine peptidases ( IPR012462 ): UfSP1 and UfSP2; both peptidases are also able to release Ufm1 from Ufm1-conjugated cellular proteins. UfSP2 is present in most, if not all, of multi-cellular organisms including plant, nematode, fly, and mammal, whereas UfSP1 is not present in plants and nematodes [ (PUBMED:17182609) ].

GO process:protein ufmylation (GO:0071569)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ufm1