The domain within your query sequence starts at position 459 and ends at position 528; the E-value for the UnbV_ASPIC domain shown below is 8.9e-18.

ARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGRDEASSVEVTWPDGKMVSRSV
ASEEMNSVLE

UnbV_ASPIC

UnbV_ASPIC
PFAM accession number:PF07593
Interpro abstract (IPR011519):

This conserved sequence is found associated with IPR001440 in several paralogous proteins in Rhodopirellula baltica. It is also found associated with IPR000413 in several eukaryotic integrin-like proteins (e.g. human ASPIC Q9NQ78) and in several other bacterial proteins (e.g. Q84HN1) [(PUBMED:12536216)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UnbV_ASPIC