The domain within your query sequence starts at position 1051 and ends at position 1215; the E-value for the Upf2 domain shown below is 1.5e-45.

NEPEEEEGSEEEEEGEEEEEENTDYLTDSNKENETDEENAEVMIKGGGLKHVPCVEDEDF
IQALDKMMLENLQQRSGESVKVHQLDVAIPLHLKSQLRKGPPLGGGEGETESADTMPFVM
LTRKGNKQQFKILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLD

Upf2

Upf2
PFAM accession number:PF04050
Interpro abstract (IPR007193):

This entry represents Up-frameshift suppressor 2 (also known as Nonsense-mediated mRNA decay protein 2). Transcripts harbouring premature signals for translation termination are recognised and rapidly degraded by eukaryotic cells through a pathway known as nonsense-mediated mRNA decay. In Saccharomyces cerevisiae, three trans-acting factors (Upf1 to Upf3) are required for nonsense-mediated mRNA decay [(PUBMED:11073994)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Upf2