The domain within your query sequence starts at position 1319 and ends at position 1515; the E-value for the Urb2 domain shown below is 2.7e-26.

IEPVLEVLAVLLRKGEESISNPHHVSLAFNILLTVPLEHLQPREFGSVFLKMHSVLFSIL
QCHSKVMLKAVPSFLNSFNRLLVSVMHEGRQKDKGSVDDLTVVLESARLVERMYSHLATR
AEEFTAFSPFLVAQYVTEVQKVTLYPPVKNLLQEGIYLILDLCMERDIQFLRASLQAGAR
DVFKDLHSDYLKYHKAK

Urb2

Urb2
PFAM accession number:PF10441
Interpro abstract (IPR018849):

This entry represents a conserved domain found towards the C terminus of proteins involved in ribosome biogenesis, such as the Urb2 protein from yeast [(PUBMED:15226434)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Urb2