The domain within your query sequence starts at position 6 and ends at position 101; the E-value for the Urm1 domain shown below is 2.1e-43.
CVKVEFGGGAELLFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRP GILVLINDADWELLGELDYQLQDQDSILFISTLHGG
Urm1 |
 |
|---|
| PFAM accession number: | PF09138 |
|---|---|
| Interpro abstract (IPR015221): | Ubiquitin related modifier 1 (Urm1) is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like urmylation pathway [ (PUBMED:16864801) ]. Structural comparisons and phylogenetic analysis of the ubiquitin superfamily has indicated that Urm1 has the most conserved structural and sequence features of the common ancestor of the entire superfamily [ (PUBMED:14551258) ]. Urm1 acts as a sulfur carrier required for 2-thiolation of mcm5S2U at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln) [ (PUBMED:21209336) ]. |
| GO process: | tRNA thio-modification (GO:0034227) |
| GO component: | cytoplasm (GO:0005737) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Urm1