The domain within your query sequence starts at position 855 and ends at position 901; the E-value for the UvrD_C_2 domain shown below is 2.3e-10.

HAWARTIHTFQGSEENTVVYVVGKAGRQHWQHVYTAVTRGRSRVYII

UvrD_C_2

 UvrD_C_2
PFAM accession number:PF13538
Interpro abstract (IPR027785):

This domain is found at the C terminus of a wide variety of helicase enzymes. This domain has an AAA-like structural fold.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry UvrD_C_2