The domain within your query sequence starts at position 867 and ends at position 931; the E-value for the UvrD_C_2 domain shown below is 1.6e-12.
ILGTVHKAKGLEFDTVHVLDDFVKVPCARHNLAQLPHFRVESFSEDEWNLLYVAVTRAKK RLIMT
UvrD_C_2 |
---|
PFAM accession number: | PF13538 |
---|---|
Interpro abstract (IPR027785): | This domain is found at the C terminus of a wide variety of helicase enzymes. This domain has an AAA-like structural fold. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry UvrD_C_2