The domain within your query sequence starts at position 3 and ends at position 107; the E-value for the V-ATPase_G domain shown below is 3e-38.

SQTQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREQEFQSKQQAA
MGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCEVR

V-ATPase_G

V-ATPase_G
PFAM accession number:PF03179
Interpro abstract (IPR005124):

This family represents the eukaryotic vacuolar (H+)-ATPase (V-ATPase) G subunit. V-ATPases generate an acidic environment in several intracellular compartments. Correspondingly, they are found as membrane-attached proteins in several organelles. They are also found in the plasma membranes of some specialised cells. V-ATPases consist of peripheral (V1) and membrane integral (V0) heteromultimeric complexes. The G subunit is part of the V1 subunit, but is also thought to be strongly attached to the V0 complex. It may be involved in the coupling of ATP degradation to H+ translocation.

GO process:proton transmembrane transport (GO:1902600)
GO component:vacuolar proton-transporting V-type ATPase complex (GO:0016471)
GO function:ATPase-coupled transmembrane transporter activity (GO:0042626)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry V-ATPase_G