The domain within your query sequence starts at position 34 and ends at position 309; the E-value for the V-ATPase_H_N domain shown below is 2.3e-7.

ESDTARYVTSKILHLAQSQEKTRREMTTKGSTGMEVLLSTLENTKDLQTVLNILSILIEL
VSSGGGRRASFLVAKGGSQILLQLLMNASKDSPPHEEVMVQTHSILAKIGPKDKKFGVKA
RVNGALTVTLNLVKQHFQNYRLVLPCLQLLRVYSTNSVNSVSLGKNGVVELMFKIIGPFS
KKNSGLMKVALDTLAALLKSKTNARRAVDRGYVQVLLTIYVDWHRHDNRHRNMLIRKGIL
QSLKSVTNIKLGRKAFIDANGMKILYNTSQECLAVR

V-ATPase_H_N

V-ATPase_H_N
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry V-ATPase_H_N