The domain within your query sequence starts at position 1 and ends at position 45; the E-value for the V-SNARE domain shown below is 4.5e-15.

QEANETLAEMEEELRYAPLTFRNPMMSKLRNYRKDLAKLHREVRS

V-SNARE

V-SNARE
PFAM accession number:PF05008
Interpro abstract (IPR007705):

V-SNARE proteins are required for protein traffic between eukaryotic organelles. The v-SNAREs on transport vesicles interact with t-SNAREs on target membranes in order to facilitate this [ (PUBMED:10359592) ]. This domain is the N-terminal half of the V-Snare proteins.

GO process:intracellular protein transport (GO:0006886)
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry V-SNARE