The domain within your query sequence starts at position 106 and ends at position 332; the E-value for the VAD1-2 domain shown below is 3e-87.
EEEEMGGRYRSIPVQTSKHLFWSNKLIQASEHSLQKALEKHHRSPQEKSISISQVYTECT QPPSSPPVSRPTTPTAIGLADLINFASSLAVASSSNMALPNLENMIKGTSEKSQNTSLDF CQPVQAIKFAQATQITQISSEKQDESPKSMAHKSWTRETRNVACSYLDINQAGLKTATIQ GEVKFVQTPIASPQLQEAKEDSVPGTKKGNPLLLKIHFKLSSPQPQR
VAD1-2 |
---|
PFAM accession number: | PF15310 |
---|---|
Interpro abstract (IPR029297): | Spermatogenesis-associated protein 32 (SPATA32, also known as VAD1-2) is expressed in testis and may be involved in acrosome formation during spermiogenesis [ (PUBMED:18621766) ]. VAD1-2 can be detected in the acrosome region of the round and elongated spermatids of mouse, human, monkey and pig. Putative interacting partners syntaxin 1, beta-actin, and myosin heavy chain (MHC) protein were identified from the co-immunoprecipitation experiments [ (PUBMED:18621766) ]. |
GO process: | spermatogenesis (GO:0007283) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry VAD1-2