The domain within your query sequence starts at position 30 and ends at position 84; the E-value for the VMA21 domain shown below is 9.9e-9.
MTFKIFLLFAGLMVKVPVGLYFSCKLLLFQSLMLMSPEDSAFYATIVSVVGLHVQ
VMA21 |
 |
|---|
| PFAM accession number: | PF09446 |
|---|---|
| Interpro abstract (IPR019013): | The vacuolar ATPase assembly integral membrane protein VMA21 is required for the assembly of the integral membrane sector (V0 component) of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum [ (PUBMED:15356264) ]. Mutations in the human VMA32 gene cause X-linked myopathy with excessive autophagy (XMEA), which is a childhood-onset disease characterised by progressive vacuolation and atrophy of skeletal muscle [ (PUBMED:19379691) ]. |
| GO process: | vacuolar proton-transporting V-type ATPase complex assembly (GO:0070072) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry VMA21