The domain within your query sequence starts at position 862 and ends at position 908; the E-value for the VPS11_C domain shown below is 5.2e-22.
PENRKVMDMIRAQEQKRDLHDQFQHQLKCSNDSFSVIADYFGRGVFN
VPS11_C |
---|
PFAM accession number: | PF12451 |
---|---|
Interpro abstract (IPR024763): | Vps 11 is one of the evolutionarily conserved class C vacuolar protein sorting genes (c-vps: vps11, vps16, vps18, and vps33), whose products physically associate to form the c-vps protein complex required for vesicle docking and fusion. This entry represents the C-terminal domain of vps11. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry VPS11_C