The domain within your query sequence starts at position 131 and ends at position 353; the E-value for the VPS13 domain shown below is 9.6e-57.

EPYWYSVTASVVTRIVENIELKIQDVHLRFEDGVTNPSRPFAFGICIKNVSMQNAANEPV
QKLMRKKRLDVAEFSIYWDVNCTLLGDLPQAELQEAMARSMESRSHHYILEPVCASALLK
RNCSKEPLRSRHSPRIECDIQLETIPLKLSQLQYRQIMAFLKELERKERQLKFRKWKPKV
AVSKNCREWWYFALNANLYEIREQRKCWTWDFLLHRARDAVFY

VPS13

VPS13
PFAM accession number:PF16908
Interpro abstract (IPR031646):

This domain is found in eukaryotic vacuolar sorting-associated 13 (VPS13) proteins. It lies towards the N terminus, just downstream from IPR026854. The exact function of this domain is not known [(PUBMED:15498460), (PUBMED:21764909)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry VPS13