The domain within your query sequence starts at position 3978 and ends at position 4126; the E-value for the VPS13_C domain shown below is 4.8e-24.

QGGTPTRYYFENLKISIPQIKLSVFTSNKLPLDLKALKSTLGFPLIRFEDAVINLDPFTR
VHPYETKEFIINDILKHFQEELLSQAARILGSVDFLGNPMGLLNDVSEGVTGLIKYGNVG
GLIRNVTHGVSNSAAKFAGTLSDGLGKTM

VPS13_C

VPS13_C
PFAM accession number:PF16909
Interpro abstract (IPR031645):

This entry represents the C-terminal domain of vacuolar sorting-associated 13 proteins. The exact function of this domain is not known [(PUBMED:15498460), (PUBMED:21764909)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry VPS13_C