The domain within your query sequence starts at position 1685 and ends at position 1883; the E-value for the VPS13_mid_rpt domain shown below is 2.8e-13.

DMSKVDGRLSLKVGCIQIVYVHKFFMSLLSFLNNFQAAKEALSTATVQAAERAASSVKDL
AQKSFRLLMDIDLKAPVITIPQSSVSPNVVIADLGLIRVENKFSLVSVEQLALPPVADEM
SIQLTQLKLARTVLQADSPQHDVEILKPVNMLLCIQRNLSAAWYTQIPGMEIKGELKPMQ
VALSQDDLTVLMKILLENL

VPS13_mid_rpt

VPS13_mid_rpt
PFAM accession number:PF16910
Interpro abstract (IPR031642):

This entry represents the repeating region of eukaryotic vacuolar sorting-associated 13. This repeating region shares a common core element that includes a well-conserved P-X4-P-X13-17-G sequence. The exact function of this repeat is not known [(PUBMED:15498460), (PUBMED:21764909)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry VPS13_mid_rpt