The domain within your query sequence starts at position 611 and ends at position 832; the E-value for the VPS13_mid_rpt domain shown below is 7.8e-71.
FETNPENSPADQTLIVQSQPVEVIYDAKTINAVVEFFQSNKGLDLEQITSATLMKLEEIK ERTATGLTHIIETRKVLDLRINLKPSYLIIPQTGFHHEKSNLLILDFGTFQLNSKDQGAQ KTANASLEEIIDKAYDKFDVEIRSVQLLFAKAEENWKKCRFQHPSTMHILQPMDIHVELA KAMVEKDVRMAKFKVSGGLPLMHVRISDQKIKDALCLINSIP
VPS13_mid_rpt |
---|
PFAM accession number: | PF16910 |
---|---|
Interpro abstract (IPR031642): | This entry represents the repeating region of eukaryotic vacuolar sorting-associated 13. This repeating region shares a common core element that includes a well-conserved P-X4-P-X13-17-G sequence. The exact function of this repeat is not known [ (PUBMED:15498460) (PUBMED:21764909) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry VPS13_mid_rpt