The domain within your query sequence starts at position 39 and ends at position 219; the E-value for the VPS28 domain shown below is 2.2e-70.

MAELFAVVKTMQALEKAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRK
FRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLR
ELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRF
L

VPS28

 VPS28
PFAM accession number:PF03997
Interpro abstract (IPR007143):

The Endosomal Sorting Complex Required for Transport (ESCRT) complexes form the machinery driving protein sorting from endosomes to lysosomes. ESCRT complexes are central to receptor down-regulation, lysosome biogenesis, and budding of HIV. Yeast ESCRT-I consists of three protein subunits, Vps23, Vps28, and Vps37. In humans, ESCRT-I comprises TSG101, VPS28, and one of four potential human VPS37 homologues. The main role of ESCRT-I is to recognise ubiquitinated cargo via the UEV domain of the VPS23/TSG101 subunit. The assembly of the ESCRT-I complex is directed by the C-terminal steadiness box (SB) of VPS23, the N-terminal half of VPS28, and the C-terminal half of VPS37. The structure is primarily composed of three long, parallel helical hairpins, each corresponding to a different subunit. The additional domains and motifs extending beyond the core serve as gripping tools for ESCRT-I critical functions [ (PUBMED:16615893) (PUBMED:16615894) ].

GO process:endosome transport via multivesicular body sorting pathway (GO:0032509)
GO component:ESCRT I complex (GO:0000813)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry VPS28